|
|
||||||||
Department of Pharmacology, Temple University School of Medicine, 3420 N. Broad Street, Philadelphia, Pennsylvania 19140, USA
1 Phoenix Pharmaceuticals Inc., Belmont, California 94002, USA
(Requests for offprints should be addressed to N J Dun; Email: ndun{at}temple.edu)
| Abstract |
|---|
|
|
|---|
| Introduction |
|---|
|
|
|---|
Obestatin was isolated and purified from the rat stomach (Zhang et al. 2005). The type(s) of cells in the gastrointestinal tract expressing obestatin has not yet been identified. Although obestatin is thought to be peripheral in origin, the peptide appears to interact with receptors distributed to the peripheral and central sites and mediate a specific behavioral response. For example, inhibition of contraction of isolated jejunum is probably mediated by a local action of obestatin; whereas, suppression of food intake and reduction of body weight gain by intracerebroventricular or i.p. injection of obestatin are proposed to be mediated through a central action (Zhang et al. 2005). For these reasons, the present study was undertaken to identify obestatin-containing cells in the rat peripheral tissues, but investigate the biological activity of obestatin on dissociated and cultured rat cortical neurons using the Fura-2 fluorescence as a functional assay.
| Materials and Methods |
|---|
|
|
|---|
Immunohistochemical procedures
Animals were anesthetized with urethane (1.2 g/kg, i.p.) and intracardially perfused with 0.1 M PBS followed by freshly prepared 4% paraformaldehyde/0.2% picric acid in PBS. A segment of stomach, small and large intestine were removed, postfixed for 2 h, and stored in 30% sucrose/PBS solution overnight. In preparing the myenteric plexus, layers of smooth muscles were scraped as much as possible by cotton swabs and the plexus was processed as a whole mount (Dun et al. 1997). In single staining, tissues were processed for obestatin immunoreactivity (irOBS) by the avidinbiotin complex procedure (Brailoiu et al. 2005b). Tissues were first treated with 3% H2O2 to quench endogenous peroxidase, washed several times and blocked with 10% normal goat serum. Tissues were then incubated in obestatin or preproghrelin antiserum for 48 h at 4 °C with gentle agitation. Obestatin antiserum, a rabbit polyclonal directed against the rat/mouse obestatin (FNAPFDVGIKLSGA-QYQQHGRAL-NH2; Phoenix Pharmaceuticals, Inc., Belmont, CA, USA), was used at a dilution of 1:1000 with 0.4% Triton X-100 and 1% BSA in PBS. Rabbits were immunized with obestatin conjugated to thyroglobulin by the N-ethyl-N'-(3-dimethylaminopropyl) carbodiimide method. Preproghrelin antiserum, a rabbit polyclonal directed against the human preproghrelin (86117; LSGVQYQQHSQALGKFLQDILWEEAKEAPADK; Phoenix Pharmaceuticals, Inc.), was used at a dilution of 1:7501000. After thorough rinsing, sections were incubated in biotinylated anti-rabbit IgG (1:150 dilution, Vector Laboratories, Burlingame, CA, USA) for 2 h. Sections were rinsed with PBS and incubated in avidinbiotin complex solution for 1 h (1:100 dilution, Vector Laboratories). Following several washes in Tris-buffered saline, sections were incubated in 0.05% diaminobenzidine/0.001% H2O2 solution and washed for at least 2 h with Tris-buffered saline. Sections were mounted on slides with 0.25% gel alcohol, air-dried, dehydrated with absolute alcohol followed by xylene, and coverslipped with Permount. To establish the specificity of obestatin or preproghrelin antiserum, myenteric sections were processed with obestatin- or preproghrelin antiserum pre-absorbed with the rat/ mouse obestatin peptide or preproghrelin (86117; 1 µg/ml) overnight.
In the case of double-labeling experiments, tissue sections were first blocked with normal goat serum (1:10 in PBS, 0.5% BSA, 0.4% Triton X-100) and then incubated in obestatin antiserum (1:750 dilution) for 48 h in a cold room, with gentle agitation. Following several washes with PBS, sections were incubated with biotinylated anti-rabbit IgG (1:50, Vector Laboratories) for 2 h. After several washes with PBS, tissues were incubated with Avidin Texas Red for 3 h. After rinsing with PBS for 1 h, tissues were blocked with normal donkey serum, and incubated with choline acetyltransferase (ChAT) antiserum (1:1000; a guinea pig polyclonal from Bachem Bio Sciences, Inc., King of Prussia, PA, USA) for 48 h in a cold room. After washing with PBS for 30 min, tissues were incubated in fluorescein isothiocyanate (FITC)-conjugated Affini Pure donkey anti-guinea pig IgG (1:50, Jackson Laboratories, West Grove, PA, USA) for 3 h. Sections were washed for 1 h with PBS, mounted in Citifluor and coverslipped. Sections were examined under a confocal scanning laser microscope (Leica TCS SL) with excitation/emission wavelengths set to 488 nm/520 nm for FITC and 543 nm/620 nm for Texas Red in the sequential mode.
Specificity of obestatin and preproghrelin antisera
Obestatin antiserum reacts 100% with rat/mouse obestatin and rat/mouse Des (110) obestatin, and does not cross-react with human/monkey obestatin, mouse/rat or human ghrelin, human preproghrelin (86117), preproghrelin (5275), or preproghrelin (101117). Preproghrelin antiserum reacts 100% with human preproghrelin (86117), and does not cross-react with rat/mouse obestatin or rat/mouse ghrelin (Phoenix Pharmaceuticals, Inc.).
Neuronal cell culture
Cells were isolated from the cerebral cortex of postnatal 13-day-old rats byenzymatic digestion with 0.5 mg papain/100 mg tissue (Brailoiu et al. 2005a). Cells were plated at a densityof 103/ mm2 in a Neurobasal-A medium, supplemented with 10% fetal calf serum, 2 mM glutamine, 100 units/ml penicillin, and 100 µg/ml streptomycin (all from Invitrogen), and maintained at 37 °C in a humidified atmosphere with 5% CO2. Glial cell growth was inhibited by the mitotic inhibitor cytosine ß-arabino furanoside (1 µM; Sigma). Neurons were cultured for 5 days. Cells were transferred to a medium without fetal serum 12 h prior to Ca2+measurements.
Cytosolic Ca2+ concentrations
Cytosolic Ca2+concentrations, [Ca2+]i, were measured by the microfluorimetric technique, as previously described (Brailoiu et al. 2005a). Dissociated and cultured neurons on coverslips were loaded with the fluorescent Ca2+ indicator Fura-2 AM (3 µM) by incubation of the cells in Hanks balanced salt solution (HBSS) plus Fura-2 AM for 45 min, and HBSS alone for an additional 1560 min to allow de-esterification of the dye. Coverslips were placed in a custom-designed bath and transferred to the stage of an inverted Nikon epifluorescence microscope equipped with a C&L Instruments Fluorimeter System (Brailoiu et al. 2005a). Cells were perfused with HBSS at a flow rate of 2.5 ml/min. Fura-2 fluorescence (excitation wavelength = 340 and 380 nm, emission wavelength = 520 nm) of single cells was acquired at a frequency of 1 Hz. The ratio of the fluorescence signals (340 nm/380 nm) was converted to Ca2+ concentrations (Grynkiewicz et al. 1985).
Statistical analysis
In calcium measurement experiments, statistical significance between groups was tested using one-way ANOVA followed by Bonferroni test, P < 0.05 being considered significantly different.
| Results |
|---|
|
|
|---|
Myenteric plexus
Ganglion cells in the myenteric plexus expressed irOBS of varying intensity (Fig. 1A
). Immunoreactivity appeared in granule-like vesicles and was distributed throughout the cytoplasm, excluding the nucleus (Fig. 1A
). Strands of irOBS cell processes emanating from myenteric ganglion cells formed a ladder-like network (Fig. 1A
). The myenteric plexus processed with obestatin antiserum pre-absorbed with obestatin (1 µg/ml) showed no immunoreactivity (Fig. 1B
).
|
In the guinea pig myenteric plexus, ghrelin immunoreactivity is expressed in ChAT-containing neurons (Xu et al. 2005). The possibility that irOBS myenteric neurons contain ChAT was explored here. Double labeling the sections with obestatin- and ChAT antisera revealed that nearly all irOBS myenteric ganglion cells were ChAT positive and vice versa (Fig. 2
).
|
In addition to the myenteric plexus, irOBS cells were noted in the mucosa throughout the gastrointestinal tract (Fig. 3
). Labeled cells were more abundant in the stomach and fewer in the small intestine (not shown). Further, irOBS cells occurred more often in the glandular base, next to the muscularis mucosae, and less frequently in the glandular neck (Fig. 3A and B
).
|
Testis
Ghrelin is expressed in rat testicular interstitial Leydig cells (Barreiro et al. 2002). Here, irOBS and irGRL were detected in Leydig cells of the rat testis (Fig. 4
).
|
The neuronal activity of obestatin was evaluated by monitoring changes of intracellular Ca2+ concentration, [Ca2+]i, in dissociated and cultured cortical neurons. The basal [Ca2+]i, value of rat dissociated cortical neurons varied from 70 to 180 nM, which is in agreement with the concentration (30200 nM) reported in mammalian central neurons (Connor 1986). In Ca2+-containing saline, application of obestatin (100 nM) induced a fast rise in [Ca2+]i of 658 ± 8.3 nM, which gradually returned to the basal level in 26 of 80 cells tested; a representative trace is shown in Fig. 5A
. In Ca2+-free saline, obestatin produced a transitory elevation in [Ca2+]i of 184 ± 4.6 nM (n = 10; Fig. 5B
). Response elicited in a Ca2+-free medium was significantly smaller (P < 0.01) as compared with that induced in a Ca2+-containing saline. The mean increase in [Ca2+]i induced by obestatin (100 nM) in a medium with or without calcium is shown in Fig. 5C
.
|
| Discussion |
|---|
|
|
|---|
In the rat, irOBS is expressed in gastrointestinal tract and testis. In the gastrointestinal tract, irOBS is detected in cells of gastric mucosa and in cells and fibers of the myenteric plexus. In the testis, irOBS is noted in Leydig cells, which form clusters in the interstitium. In a separate series of studies, immunoreactivity to the precursor protein preproghrelin is noted in cells of the gastric mucosa, myenteric plexus and in interstitial Leydig cells. Thus, the distribution pattern of irGRL cells parallels that of irOBS cells in the rats. Since these two antisera were raised in rabbits, double-labeling experiments that would address the issue of co-localization of obestatin and preproghrelin could not be reliably performed. Notwithstanding the same precursor protein, the similarity in tissue distribution between these two peptides supports the hypothesis that they are distributed in the same cells.
Insofar as ghrelin immunoreactivity is concerned, several earlier studies show that it is detected in cells of the gastrointestinal mucosa from stomach to colon (Date et al. 2000, Dornonville de la Cour et al. 2001, Sakata et al. 2002), myenteric plexus (Xu et al. 2005), and testis (Barreiro et al. 2002, Tena-Sempere et al. 2002). A parallel expression pattern between ghrelin-containing cells reported by others and obestatin-expressing cells observed in this study is consistent with the fact that they arise from the same precursor protein. However, distribution of ghrelin immunoreactivity in myenteric plexus and mucosa membrane appears to be species dependent. For example, ghrelin immunoreactivity has been detected in cells of the gastrointestinal mucosa but absent in the myenteric plexus of the rat (Sakata et al. 2002). A more recent study shows the presence of ghrelin immunoreactivity in the guinea pig myenteric plexus (Xu et al. 2005). Our finding that irOBS and irGRL are detectable in myenteric neurons of the rat supports the contention that ghrelin is expressed in myenteric neurons of the rat. Further, the number of ghrelinimmunoreactive cells and their contents has been reported to be lower in the hamster gastric mucosa as compared with that in the mouse or rat (Yabuki et al. 2004).
In the guinea pig myenteric plexus, a majority (>70%) of ghrelin-immunoreactive cells are reported to be ChAT positive (Xu et al. 2005). Our result shows that nearly all irOBS cells in the myenteric plexus of the rat were ChAT positive and vice versa, supporting the contention that irOBS is distributed in cholinergic neurons of the myenteric plexus. Our observation coupled with the earlier finding of co-expression of ghrelin immunoreactivity and ChAT (Xu et al. 2005) raise the possibility that a majority of cholinergic neurons of the myenteric plexus contain both obestatin and ghrelin. A large percentage of ChAT-containing neurons in the myenteric plexus are secretomotor neurons, though some are thought to be intrinsic primary afferent neurons (Pfannkuche et al. 1998, Sang & Young 1998, Mann et al. 1999). It remains to be determined whether or not obestatin is distributed in ChAT-positive secretomotor or primary afferent neurons or both. Exogenous obestatin, when applied to isolated mouse jejunum, inhibits isometric contractions and opposes the stimulatory action of ghrelin (Zhang et al. 2005), suggesting that obestatin is inhibitory to gastrointestinal tract motility. On the other hand, ghrelin is stimulatory to gastric motility (Peeters 2005). The concept that two peptides derived from the same precursor protein may differentially modulate the activity of smooth muscle cells and other target cells is intriguing.
In addition to the myenteric plexus, irOBS or irGRL is detected in cells of the mucosa membrane and in interstitial Leydig cells of the testis. Neither the type(s) of cells expressing irOBS in the mucosa membrane is known nor is the physiological role of obestatin in relation to gastric function. As in the case of ghrelin-containing cells (Sakata et al. 2002), irOBS cells are more numerous in the glandular base and fewer in the glandular neck of the gastric glands; also the number of irOBS cells is smaller in the small intestine as compared with that of the stomach. On the basis of their morphology, two types of ghrelin-containing cells are distinguishable: an open and closed type (Sakata et al. 2002). In an ultrastructural study, ghrelin immunoreactivity is identified in a distinct type of endocrine cells, with round, electron dense granules, referred to as X/A cells, from the mucosal layer of the stomach (Date et al. 2000).
Interstitial Leydig cells of the rat testis contain ghrelin throughout postnatal development and adulthood (Barreiro et al. 2002, Tena-Sempere et al. 2002). Our result shows the detection of irOBS as well as irGRL in Leydig cells, which again seems to support the hypothesis that ghrelin and obestatin derived from the same precursor. Recently, insulin-like peptide 6 has been identified in the Leydig cells of the mouse testis (Brailoiu et al. 2005b). Information regarding the physiological function of ghrelin or insulin-like peptide 6 in relation to reproductive biology is limited. Ghrelin signaling has been suggested to be involved in the direct control of gonadal function in male rat (Tena-Sempere et al. 2002). In addition, ghrelin has central effects on hypothalamopituitarygonadal axis, for example, inhibiting luteinizing hormone secretion (Fernandez-Fernandez et al. 2004). A physiological role of obestatin in reproduction remains to be identified. The possibility that ghrelin and obestatin may cause opposing effects in the reproductive system is intriguing.
We show for the first time that activation of obestatin receptors elevated intracellular Ca2+ in a population of cultured rat cortical neurons. An increase in neuronal [Ca2+]i is produced by an influx of calcium through plasmalemmal calcium channels and/or release from internal stores (Berridge 1998). In our model, obestatin was able to elevate [Ca2+]i in Ca 2+-free saline, indicating the participation of calcium released from internal calcium stores. The response in Ca2+-free saline was significantly smaller than that in Ca2+-containing saline, indicating that obestatin causes a large calcium influx through plasmalemmal channels. Collectively, our result suggests that obestatin increases intracellular calcium by facilitating calcium influx and by releasing calcium from internal sources. Calcium mobilization subsequent to receptor activation is associated with an array of neuronal activities; i.e., synaptic transmission, neurite outgrowth or retraction, and cell growth or apoptosis (Berridge 1998, Augustine et al. 2003). The type(s) of neuronal responses associated with activation of obestatin receptors remains to be investigated.
GPR39, which is present in many regions of the brain including the cerebral cortex, is proposed to be the cogent receptor for obestatin (Zhang et al. 2005). Results from more recent studies seem to be in variant with the concept that obestatin is an anti-orexingenic agent released from peripheral cells and exerts its effect by interacting with GPR39 distributed to central neurons, as proposed by Zhang et al.(2005). For example, GPR39 mRNA, while detectable in many areas of the brain including the mouse hypothalamus by reverse transcriptase-PCR method (Zhang et al. 2005), is not detected in the mouse hypothalamus by in situ hybridization (Jackson et al. 2006). In addition, the serum level of obestatin is high in the mouse; however, the peptide is apparently absent from the brain because it is not transported across the bloodbrain barrier due to a high degradation rate in the circulation (Pan et al. 2006). The reported absence of circulating obestatin in the brain (Pan et al. 2006) and GPR39 in the hypothalamus (Jackson et al. 2006) coupled with the lack of information regarding central neurons immunoreactive to obestatin render the hypothesis put forth by Zhang et al.(2005) less compelling. Our finding that obestatin mobilizes calcium in cortical neurons neither supports nor refutes necessarily the hypothesis that obestatin is the endogenous ligand for GPR39 (Zhang et al. 2005). Receptor characterization awaits the development of pharmacological tools specific for analyzing GPR39.
| Funding |
|---|
| References |
|---|
|
|
|---|
Barreiro ML, Gaytán F, Caminos E, Pinilla L, Casanueva FF, Aguilar E, Diéguez C & Tena-Sempere M 2002 Cellular location and hormonal regulation of ghrelin expressin in rat testis. Biology of Reproduction 67 17681776.
Berridge MJ 1998 Neuronal calcium signaling. Neuron 21 1326.[CrossRef][Web of Science][Medline]
Brailoiu E, Hoard JL, Filipeanu CM, Brailoiu GC, Dun SL, Patel S & Dun NJ 2005a Nicotinic acid adenine dinucleotide phosphate potentiates neurite outgrowth. Journal of Biological Chemistry 280 56465650.
Brailoiu GC, Dun SL, Yin D, Yang J, Chang JK & Dun NJ 2005b Insulin-like 6 immunoreactivity in the mouse brain and testis. Brain Research 1040 187190.[CrossRef][Web of Science][Medline]
Broglio F, Prodam F, Riganti F, Muccioli G & Ghigo E 2006 Ghrelin: from somatotrope secretion to new perspectives in the regulation of peripheral metabolic functions. Frontiers of Hormone Research 35 102114.[Web of Science][Medline]
Connor JA 1986 Digital imaging of free calcium changes and of spatial gradients in growing processes in single, mammalian central nervous system cells. PNAS 83 61796183.
Date Y, Kojima M, Hosoda H, Sawaguchi A, Mondal MS, Suganuma T, Matsukura S, Kangawa K & Nakazato M 2000 Ghrelin, a novel growth hormone-releasing acylated peptide, is synthesized in a distinct endocrine cell type in the gastrointestinal tracts of rats and humans. Endocrinology 141 42554261.
Dornonville de la Cour C, Björkqvist M, Sadvik AK, Bakke I, Zhao C-M, Chen D & Håkanson R 2001 A-like cells in the rat stomach contain ghrelin and do not operate under gastrin control. Regulatory Peptides 99 141150.[CrossRef][Web of Science][Medline]
Dun NJ, Dun SL, Lin HH, Hwang LL, Saria A & Fischer-Colbrie R 1997 Secretoneurin-like immunoreactivity in rat sympathetic, enteric and sensory ganglia. Brain Research 760 816.[CrossRef][Web of Science][Medline]
Fernandez-Fernandez R, Tena-Sempere M, Aguilar E & Pinilla L 2004 Ghrelin effects on gonadotropin secretion in male and female rats. Neuroscience Letters 362 103107.[CrossRef][Web of Science][Medline]
Grynkiewicz G, Poenie M & Tsien RY 1985 A new generation of Ca2+ indicators with greatly improved fluorescence properties. Journal of Biological Chemistry 260 34403450.
Gualillo O, Lago F, Casanueva FF & Dieguez C 2006 One ancestor, several peptides Post-translational modifications of preproghrelin generate several peptides with antithetical effects. Molecular and Cellular Endocrinology 256 18.[CrossRef][Web of Science][Medline]
Jackson VR, Nothacker HP & Civelli O 2006 GPR39 receptor expression in the mouse brain. Neuroreport 17 813816.[CrossRef][Web of Science][Medline]
Kojima M, Hosoda H, Date Y, Nakazato M, Matsuo H & Kangawa K 1999 Ghrelin is a growth-hormone-releasing acylated peptide from stomach. Nature 402 656660.[CrossRef][Medline]
Mann PT, Furness JB & Southwell BR 1999 Choline acetyltransferase immunoreactivity of putative intrinsic primary afferent neurons in the rat ileum. Cell and Tissue Research 297 241248.[CrossRef][Web of Science][Medline]
McKee KK, Tan CP, Palyha OC, Liu J, Feighner SD, Hreniuk DL, Smith RG, Howard AD & Van der Ploeg LH 1997 Cloning and characterization of two human G protein-coupled receptor genes (GPR38 and GPR39) related to the growth hormone secretagogue and neurotensin receptors. Genomics 46 426434.[CrossRef][Web of Science][Medline]
Pan W, Tu H & Kastin AJ 2006 Differential BBB interactions of three ingestive peptides: obestatin, ghrelin, and adiponectin. Peptides 27 911916.[CrossRef][Web of Science][Medline]
Peeters TL 2005 Grehlin: a new player in the control of gastrointestinal functions. Gut 54 16381649.
Pfannkuche H, Reiche D, Sann H & Schemann M 1998 Different subpopulations of cholinergic and nitrergic myenteric neurons project to mucosa and circular muscle of the guinea-pig gastric fundus. Cell and Tissue Research 292 463475.[CrossRef][Web of Science][Medline]
Sakata I, Nakamura K, Yamazaki M, Matsubara M, Hayashi Y, Kangawa K & Sakai T 2002 Ghrelin-producing cells exist as two types of cells, closed- and opened-type cells, in the rat gastrointestinal tract. Peptides 23 531536.[CrossRef][Web of Science][Medline]
Sang Q & Young HM 1998 The identification and chemical coding of cholinergic neurons in the small and large intestine of the mouse. Anatomical Record 251 185199.[CrossRef][Medline]
Szentirmai E & Krueger JM Obestatin alters sleep in rats. Neuroscience Letters 404 222226.
Szentirmai E, Hajdu I, Obal F Jr & Krueger JM 2006 Ghrelin-induced sleep responses in ad libitum fed and food-restricted rats. Brain Research 1088 131140.[CrossRef][Web of Science][Medline]
Tena-Sempere M, Barreiro ML, Gonzalez LC, Gaytan F, Zhang FP, Caminos JE, Pinilla L, Casanueva FF, Dieguez C & Aguilar E 2002 Novel expression and functional role of ghrelin in rat testis. Endocrinology 143 717725.
Xu L, Depoortere I, Tomasetto C, Zandecki M, Tang M, Timmermans J-T & Peeters TL 2005 Evidence for the presence of motilin, ghrelin, and the motilin and ghrelin receptor in neurons of the myenteric plexus. Regulatory Peptides 124 119125.[CrossRef][Web of Science][Medline]
Yabuki A, Ojima T, Kojima M, Nishi Y, Mifune H, Matsumoto M, Kamimura R, Masuyama T & Suzuki S 2004 Characterization and species differences in gastric ghrelin cells from mice, rats and hamsters. Journal of Anatomy 205 239246.[CrossRef][Web of Science][Medline]
Zhang JV, Ren P-G, Avsian-Kretchmer O, Luo C-W, Rauch R, Klein C & Hsueh AJW 2005 Obestatin, a peptide encoded by the ghrelin gene, opposes ghrelins effects on food intake. Science 310 996999.
Received in final form 25 July 2006
Accepted 10 August 2006
Made available online as an Accepted Preprint 25 August 2006
This article has been cited by other articles:
![]() |
C.-Y. Chen, A. Asakawa, M. Fujimiya, S.-D. Lee, and A. Inui Ghrelin Gene Products and the Regulation of Food Intake and Gut Motility Pharmacol. Rev., December 1, 2009; 61(4): 430 - 481. [Abstract] [Full Text] [PDF] |
||||
![]() |
C. J P Alvarez, M. Lodeiro, M. Theodoropoulou, J. P Camina, F. F Casanueva, and Y. Pazos Obestatin stimulates Akt signalling in gastric cancer cells through {beta}-arrestin-mediated epidermal growth factor receptor transactivation Endocr. Relat. Cancer, June 1, 2009; 16(2): 599 - 611. [Abstract] [Full Text] [PDF] |
||||
![]() |
J. V. Zhang, H. Jahr, C.-W. Luo, C. Klein, K. Van Kolen, L. Ver Donck, A. De, E. Baart, J. Li, D. Moechars, et al. Obestatin Induction of Early-Response Gene Expression in Gastrointestinal and Adipose Tissues and the Mediatory Role of G Protein-Coupled Receptor, GPR39 Mol. Endocrinol., June 1, 2008; 22(6): 1464 - 1475. [Abstract] [Full Text] [PDF] |
||||
![]() |
W. K Samson, G. L C Yosten, J.-K. Chang, A. V Ferguson, and M. M White Obestatin inhibits vasopressin secretion: evidence for a physiological action in the control of fluid homeostasis J. Endocrinol., March 1, 2008; 196(3): 559 - 564. [Abstract] [Full Text] [PDF] |
||||
![]() |
J. V. Zhang, C. Klein, P.-G. Ren, S. Kass, L. V. Donck, D. Moechars, and A. J. W. Hsueh Response to Comment on "Obestatin, a Peptide Encoded by the Ghrelin Gene, Opposes Ghrelin's Effects on Food Intake" Science, February 9, 2007; 315(5813): 766d - 766d. [Abstract] [Full Text] [PDF] |
||||
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HOME | HELP | CONTACT US | SUBSCRIPTIONS | ARCHIVE | SEARCH | TABLE OF CONTENTS |